PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G291200.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 195aa    MW: 22034.8 Da    PI: 7.5541
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G291200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.59.5e-112361448
                       HHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding 14 davkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       d+++ +G+g+W+++a+  g++R++k+c++rw +yl
  Aqcoe3G291200.2.p  2 DYIRVHGKGRWNRVAKLTGLKRCGKSCRLRWINYL 36
                       78999****************************97 PP

2Myb_DNA-binding621.2e-194287148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g +T+eEd+l+++++k+lG++ W++Ia +++ gRt++q+k++w+++l
  Aqcoe3G291200.2.p 42 KGDFTEEEDDLIIRLHKLLGNR-WSLIAGRVP-GRTDNQVKNHWNTHL 87
                       689*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-17143IPR009057Homeodomain-like
PROSITE profilePS5129412.636136IPR017930Myb domain
SMARTSM007173.9238IPR001005SANT/Myb domain
PfamPF002496.0E-9236IPR001005SANT/Myb domain
CDDcd001674.85E-6236No hitNo description
SuperFamilySSF466894.39E-252294IPR009057Homeodomain-like
PROSITE profilePS5129429.7913791IPR017930Myb domain
SMARTSM007171.4E-184189IPR001005SANT/Myb domain
PfamPF002493.1E-184287IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-274491IPR009057Homeodomain-like
CDDcd001671.94E-144587No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MDYIRVHGKG RWNRVAKLTG LKRCGKSCRL RWINYLSPSV KKGDFTEEED DLIIRLHKLL  60
GNRWSLIAGR VPGRTDNQVK NHWNTHLSKK LGITKRQQKF VVSSPTVPEN DKEEADETNT  120
HSNNANIELP GYDSNGGVIV NDYSSQSVVA EFSNTPNDCL VGSSWFSNDY LSLGYPSLMD  180
LTDMFPIEFL WDGL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-2619139128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279128.22e-71PREDICTED: transcription factor WER
SwissprotQ9SEI01e-57WER_ARATH; Transcription factor WER
TrEMBLA5BI149e-72A5BI14_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g08480.t016e-71(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.17e-59myb domain protein 66